Cagrilintide

Product Details

1. Chemical Identity and Properties
2. Primary Uses and Effects
3. Notable Scientific Studies
4. Emerging and Future Research Directions
5. Sources
6. Disclaimer

1. Chemical Identity and Properties

1. CAS Number: 1415456-99-3
2. Molecular Formula: C₂₁₀H₃₁₄N₅₄O₆₃S₂
3. Molar Mass: ~4409 g/mol
4. Synonyms: AM833, AT42613
5. Amino Acid Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (X = Lysine residue conjugated with a fatty acid for prolonged action)
6. PubChem SID: 167312356

2. Primary Uses and Effects

Appetite Suppression

Amylin helps reduce hunger by signaling to the brain that the body has eaten enough. Cagrilintide mimics this function, helping users feel full sooner and stay full longer after meals. This results in significantly lower calorie intake and supports long-term weight reduction⁴.

Delayed Gastric Emptying

Cagrilintide also slows the rate at which food moves from the stomach to the small intestine. This not only enhances satiety but also blunts post-meal blood sugar spikes, supporting more stable glucose levels throughout the day².

Weight Loss and Metabolic Benefits

By combining these effects, cagrilintide produces clinically meaningful weight loss and may also help improve markers of metabolic health such as blood glucose, cholesterol, and liver fat. In clinical trials, participants lost up to 10% of their body weight using cagrilintide alone over 26 weeks⁴, with even more substantial losses seen when combined with GLP-1 receptor agonists like semaglutide⁵.

3. Notable Scientific Studies

Phase II Obesity Study (The Lancet, 2021)⁴

In a 26-week randomized trial of 706 adults with obesity, cagrilintide was administered at various doses (up to 4.5 mg weekly). Participants on the highest dose lost 10.8% of their body weight, compared to 9% with liraglutide 3.0 mg and only 3% with placebo. Even lower doses of cagrilintide showed dose-dependent effects. The study confirmed its strong appetite-suppressing action and tolerability, with mild gastrointestinal side effects such as nausea being the most common.

Phase II Diabetes Combination Study (The Lancet, 2023)⁵

In another trial involving adults with type 2 diabetes, cagrilintide (2.4 mg weekly) was tested both alone and in combination with semaglutide (2.4 mg). The combination led to an average weight loss of 15.6%, compared to 5.1% for semaglutide alone and 8.1% for cagrilintide alone. Additionally, participants on the combination achieved greater reductions in HbA1c, a key measure of blood sugar control, supporting the synergy between the amylin and GLP-1 pathways.

REDEFINE 2 – Phase III Obesity + Diabetes (2025, Topline Results)⁷

In a large-scale 68-week Phase III trial of over 1,200 adults with obesity and type 2 diabetes, a fixed-dose combination of cagrilintide and semaglutide produced an average weight loss of 13.7%, significantly more than the 3.4% seen in the placebo group. Nearly 90% of participants achieved at least 5% weight loss, with 40% losing over 25% of their body weight. The results validate cagrilintide’s impact in a real-world population with metabolic disease.

4. Emerging and Future Research Directions

Advanced Obesity Management

With significant and sustained weight loss shown in trials, cagrilintide is being explored as a long-term treatment for obesity, both on its own and in fixed-dose combinations.

Cardiometabolic Disease

Future studies aim to assess whether the peptide’s weight loss benefits translate into reduced cardiovascular risk, improved liver function, and better cholesterol levels.

Combination Therapies

The combination of cagrilintide with GLP-1 receptor agonists (often referred to as “CagriSema”) is being studied further to determine optimal dosing, tolerability, and broader patient applicability. Early results suggest this could become a gold-standard therapy for weight loss and diabetes management.

Neurohormonal and Cognitive Research

Amylin analogues are also being investigated in preclinical models of neurodegenerative disease, such as Alzheimer’s, based on their potential role in insulin signaling and amyloid clearance⁶. While still in early stages, this adds a compelling dimension to cagrilintide’s long-term research interest.

5. Sources

1. Lau DCW, et al. Once-weekly cagrilintide for weight management in people with overweight and obesity: a multicentre, randomised, double-blind, placebo-controlled and active-controlled, dose-finding phase 2 trial. The Lancet. 2021;398(10317):2160–2172.
2. Lutz TA. Amylinergic control of food intake and obesity. Physiol Behav. 2010;100(5):511-518.
3. Kruse T, et al. Development of Cagrilintide, a Long-Acting Amylin Analogue. J Med Chem. 2021;64(15):11183–11194.
4. Lau DCW, et al. Dose-ranging phase 2 trial of cagrilintide for obesity. The Lancet. 2021;398:2160–2172.
5. Frias JP, et al. Cagrilintide and semaglutide co-administration in type 2 diabetes: A phase 2 trial. The Lancet. 2023;402(10403):720–730.
6. Coskun T, et al. Incretin and amylin receptor agonists: a unified pathway to combat metabolic and cognitive disorders? Cell Metab. 2022;34(5):713-715.
7. Kang J. Significant Weight Loss Observed With CagriSema in REDEFINE 2 Trial. Endocrinology Advisor. Published March 12, 2025.

6. Disclaimer

Cagrilintide is for research use only. It is not approved by the FDA or any regulatory agency for human or veterinary use, consumption, or therapeutic applications of any kind. By purchasing this product, you agree to our Terms and Conditions.